Table Of Content1
Joint Power Allocation and User Association
Optimization for Massive MIMO Systems
Trinh Van Chien Student Member, IEEE, Emil Björnson, Member, IEEE, and Erik G. Larsson, Fellow, IEEE
Abstract—This paper investigates the joint power allocation unfavorablechannelproperties.InMassiveMIMO,eachBSis
and user association problem in multi-cell Massive MIMO equippedwithhundredsofantennasandservessimultaneously
(multiple-input multiple-output) downlink (DL) systems. The
tens of users. Since there are many more antennasthan users,
target is to minimize the total transmit power consumption
6 simple linear processing techniques such as MRT or ZF, are
when each user is served by an optimized subset of the base
1 stations (BSs), using non-coherent joint transmission. We first closetooptimal.Theestimationoverheadismadeproportional
0
derive a lower bound on the ergodic spectral efficiency (SE), to the number of users by sending pilot signals in the uplink
2
which is applicable for any channel distribution and precoding (UL) and utilizing the channel estimates also in the DL by
ul scheme.Closed-formexpressionsareobtainedforRayleighfading virtue of time-division duplex (TDD).
channelswitheithermaximumratiotransmission(MRT)orzero
J Because80%ofthepowerincurrentnetworksisconsumed
forcing(ZF)precoding.Fromthesebounds,wefurtherformulate
7 the DL power minimization problems with fixed SE constraints at the BSs [11], the BS technology needs to be redesigned to
for the users. These problems are proved to be solvable as reduce the power consumption as the wireless traffic grows.
] linear programs, giving the optimal power allocation and BS- Many researchers have investigated how the physical layer
T
userassociationwithlowcomplexity.Furthermore,weformulate
transmissions can be optimized to reduce the transmit power,
I a max-min fairness problem which maximizes the worst SE
. while maintaining the quality-of-service(QoS); see [11]–[16]
s among the users, and we show that it can be solved as a
c quasi-linear program. Simulations manifest that the proposed andreferencestherein.Inparticular,theprecodingvectorsand
[ methodsprovidegoodSEfortheusersusinglesstransmitpower power allocation were jointly optimized in [12] under perfect
2 than in small-scale systems and the optimal user association channel state information (CSI). The algorithm was extended
can effectively balance the load between BSs when needed.
v in [13] to also handle the BS-user association, which is of
Even though our framework allows the joint transmission from
6 paramount importance in heterogeneously deployed networks
multipleBSs,thereisanoverwhelmingprobabilitythatonlyone
3
BS is associated with each user at the optimal solution. and when the users are heterogeneouslydistributed. However,
4
[13] did not include any power constraints at the BSs, which
2 Index Terms—MassiveMIMO,userassociation, poweralloca-
0 tion, load balancing, linear program. could lead to impractical solutions. In contrast, [14] showed
. thatmostjointpowerallocationandBS-userassociationprob-
1
lems with power constraints are NP-hard. The recent papers
0
6 I. INTRODUCTION [15],[16] considera relaxed problemformulationwhere each
1 The exponentialgrowth in wireless data traffic and number user can be associated with multiple BSs and show that these
v: of wireless devices cannot be sustained by the current cel- problems can be solved by convex optimization.
i lular network technology. The fifth generation (5G) cellular The papers [12]–[16] are all optimizing power with re-
X
networksare expectedto bring thousand-foldsystem capacity spectto the small-scale fading,whichis verycomputationally
r improvements over contemporary networks, while also sup- demanding since the fading coefficients change rapidly (i.e.,
a
porting new applications with massive number of low-power every few milliseconds). It is also unnecessary to compensate
devices, uniform coverage, high reliability, and low latency for bad fading realizations by spending a lot of power on
[2], [3]. These are partially conflicting goals that might need having a constant QoS, since it is typically the average QoS
a combination of several new radio concepts; for example, that matters to the users. In contrast, the small-scale fading
MassiveMIMO[4],millimeterwavecommunications[5],and has negligible impact on Massive MIMO systems, thanks to
device-to-device communication [6]. favorable propagation [17], and closed-form expressions for
Among them, Massive MIMO, a breakthrough technology the ergodicSE are available for linearprecodingschemes[7].
proposedin [4],hasgainedlotsof attentionrecently[7]–[10]. The power allocation can be optimized with respect to the
It is considered as an heir of the MIMO technology since its slowly varying large-scale fading instead [8], which makes
scalability can provide very large multiplexing gains, while advanced power control algorithms computationally feasible.
previous single-user and multi-user MIMO solutions have A few recent works have considered power allocation for
been severely limited by the channelestimation overheadand Massive MIMO systems. For example, the authors in [18]
formulated the DL energy efficiency optimization problem
The authors are with the Department of Electrical Engineering
for the single cell Massive MIMO systems that takes both
(ISY), Linköping University, 581 83 Linköping, Sweden (email:
[email protected]; [email protected]; [email protected]). the transmit and circuit powers into account. The paper [19]
ThispaperwassupportedbytheEuropeanUnion’sHorizon2020research considered optimized user-specific pilot and data powers for
and innovation programme under grant agreement No 641985 (5Gwireless).
given QoS constraints, while [20] optimized the max-min SE
ItwasalsosupportedbyELLIITandCENIIT.
Partsofthispaperwerepresented atIEEEICC2016[1]. and sum SE. None of these papers have considered the BS-
2
user association problem.
Massive MIMO hasdemonstratedhighenergyefficiencyin
homogeneously loaded scenarios [7], where an equal number
of users are preassigned to each BS. At any given time, the
user load is typically heterogeneously distributed, such that
some BSs have many more users in their vicinity than others.
Large SE gains are often possible by balancing the load over
the network [21],[22], using some other user association rule
than the simple maximum signal-to-noise ratio (max-SNR)
association. Instead of associating a user with only one BS,
coordinated multipoint (CoMP) methods can be used to let
multiple BSs jointly serve a user [23]. This can either be
implemented by sending the same signal from the BSs in a Fig. 1. A multiple-cell Massive MIMO DL system where users can be
coherent way, or by sending different simultaneous signals in associatedwithmorethanoneBS(e.g.,redusers).TheoptimizedBSsubset
foreachuserisobtained fromtheproposedoptimization problem.
a non-coherentway. However,finding the optimalassociation
is a combinatorial problem with a complexity that scales
exponentially with the network size [22]. Such association
The effectiveness of our novel algorithms and analytical
rules are referredto as a partof CoMP jointtransmission and •
results are demonstrated by extensive simulations. These
have attracted significant interest because of their potential
show that the power allocation, array gain, and BS-user
to increase the achievable rate [21], [23]. While load bal-
association are all effective means to decrease the power
ancing is a well-studied problem for heterogeneousmulti-tier
consumptioninthecellularnetworks.Moreover,weshow
networks, the recent works [24]–[26] have shown that large
that the max-min algorithm can provide uniformly great
gains are possible also in Massive MIMO systems. From the
SEforallusers,irrespectiveofuserlocations,andprovide
game theory point of view, the author in [24] proposed a
a map thatshowshow the probabilityof beingservedby
user association approach to maximize the SE utility while
a certain BS depends on the user location.
taking pilot contaminationinto account. Apart from this, [25]
This paper is organized as follows: Section II presents the
consideredthe sum SE maximizationof a network where one
multi-cell Massive MIMO system model and derives lower
user is associated with one BS. We note that [24], [25] only
bounds on the ergodic SE. In Section III the transmit power
investigated user association problems for a given transmit
minimization problem is formulated. The optimal solution
power at the BSs. Different from [24], [25], the total power
is obtained in Section IV where also the optimal BS-user
consumption minimization problems with optimal and sub-
association rule is obtained, while an algorithm for max-min
optimal precoding schemes were investigated in [26].
SE optimization is derived in Section V. Finally, Section VI
In this paper we jointly optimize the power allocation
gives numerical results and Section VII summarizes the main
and BS-user association for multi-cell Massive MIMO DL
conclusions.
systems. Specifically, our main contributions are as follows:
Notations: We use upper-case bold face letters for matrices
We derive a new ergodic SE expression for the scenario
• whentheuserscanbeservedbymultipleBSs,usingnon- and lower-case bold face ones for vectors. IM and IK are the
identity matrices of size M M and K K, respectively.
coherent joint transmission and decoding the received The operator E is the ex×pectation of a×random variable.
signals in a successive manner. Closed-form expressions {·}
The notation stands for the Euclidean norm and tr() is
are derived for MRT and ZF precoding. k·k ·
the trace of a matrix. The regular and Hermitian transposes
We formulate a transmit power minimization problem
• are denoted by ()T and ()H, respectively. Finally, (.,.)
under ergodic SE requirements at the users and limited · · CN
is the circularly symmetric complex Gaussian distribution.
power budget at the BSs. This problem is shown to be a
linear program when the new ergodic SE expression for
MRT or ZF is used, so the optimal solution is found in II. SYSTEMMODELAND ACHIEVABLE PERFORMANCE
polynomial time. A schematic diagram of our system model is shown in
The optimal BS-user association rule is obtained from Fig. 1. We consider a Massive MIMO system with L cells.
•
the transmit power minimization problem. This rule re- EachcellcomprisesaBSwithM antennas.Thesystemserves
veals how the optimal association depends on the large- K single antenna users in the same time-frequency resource.
scale fading, estimation quality, signal-to-interference- Note that each user is conventionally associated and served
and-noise ratio (SINR), and pilot contamination. Inter- by only one of the BSs. However, in this paper, we optimize
estingly, only a subset of BSs serves each user at the the BS-user association and investigate when it is preferable
optimal solution. to associate a userwith multipleBSs. Therefore,the usersare
We consider the alternative option of optimizing the numberedfrom1toK withouthavingpredefinedcellindices.
•
SE targets utilizing max-min SE formulation with user- Weassumethatthechannelsareconstantandfrequency-flat
specificweights.Thisproblemisshowntobequasi-linear in a coherence interval of length τ symbols and the system
c
and can be solved by an algorithm that combines the operates in TDD mode. In detail, τ symbols are used for
p
transmit power minimization with the bisection method. channel estimation, so the remaining portion of a coherence
3
block including τ τ symbols are dedicated for the data Lemma 1. BS l can estimate the channel to user k using
c p
−
transmission. In the UL, the received baseband signal y MMSE estimation from the following equation,
l
CM at BS l, for l =1,...,L, is modeled as ∈
K Ylφφφk =HlP1/2ΦΦΦHφφφk+Nlφφφk =τp √pt′hl,t′ +n˜l,k,
yl = hl,t√ptxt+nl, (1) t′X∈Pk (6)
t=1
X
nwohremrealipztedistrathnesmtritanssymmibtoploxwterwiothf Eus{e|rxtt|2}ass=ign1e.dAttoeatchhe hwˆlh,kereofn˜tlh,ke=chaNnlnφφφekl h∼l,CkNbe(t0w,eτepnσU2BLSIlMa)n.dThueseMrMkSiEs estimate
BS, the receiver hardware is contaminated by additive noise
bneltw∼eeCnNus(e0r,σtU2aLnIdMB).STlh.eInvethcitsorpahpl,etr,dweneocteosnstihdeerchuanncnoer-l hˆl,k = τ √ppkββl,k +σ2 Ylφφφk (7)
related Rayleigh fading channels, meaning that the channel p t′∈Pk t′ l,t′ UL
realizations are independent between users, BS antennas and and the estimation errPor is defined as
between coherence intervals. Mathematically, each channel
e =hˆ h . (8)
vector h , for t=1,...,K, is a realization of the circularly l,k l,k l,k
l,t −
symmetric complex Gaussian distribution
Consequently, the channel estimate and the estimation error
h (0,β I ). (2) are independent and distributed as
l,t l,t M
∼CN
The variance βl,t describes the large-scale fading which, for hˆl,k (0,θl,kIM), (9)
example, symbolizesthe attenuation of signals due to diffrac- ∼CN
e (0,(β θ )I ), (10)
tion around large objects such as high buildings and due to l,k ∼CN l,k− l,k M
propagationoveralongdistancebetweentheBSanduser.Let
where
us define the channel matrix Hl =[hl,1,...,hl,K] CM×K, p τ β2
the diagonal power matrix P = diag(p ,...,p ) ∈ CK K, θ = k p l,k . (11)
and the useful signal vector xl = [xl,11,...,xlK,M]∈T ∈ C×M. l,k τp t′∈Pkpt′βl,t′ +σU2L
Thus, the UL received signal at BS l in (1) can be written as Proof: The proofPfollows from the standard MMSE
y =H P1/2x +n . (3) estimation of Gaussian random variables [27].
l l l l
In a compact form, each BS l produces a channel estimate
EachBS in a Massive MIMOsystem needsCSI in orderto matrixH =[hˆ ,...,hˆ ] CM K andthe mismatchwith
l l,1 l,k ×
make efficient use of its antennas; for example, to coherently the true channel matrix H ∈is expressed by the uncorrelated
l
combine desired signals and reject interfering ones. BSs do error mbatrix El = [el,1,...,el,K] CM×K. Lemma 1
not have CSI a priori, which calls for CSI estimation from providesthestatistical propertiesofthe∈channelestimatesthat
UL pilot signals in every coherence interval. areneededto analyzeutility functionslikethe DL ergodicSE
in multi-cell Massive MIMO systems. At this point, we note
that the channel estimates of two users t and k in the set
A. Uplink Channel Estimation k
P
are correlated since they use the same pilot. Mathematically,
The pilot signals are a part of the UL transmission. We
they are only different from each other by a scaling factor
assume that user k transmit the pilot sequence φφφ of length
k
τp symbols described by the UL model in (3). We let Pk ⊂ hˆ = √pkβl,khˆ . (12)
{1,...,K} denote the set of user indices, including user k, l,k √ptβl,t l,t
that use the same pilot sequence as user k. Thus, the pilot
sequences are assumed to be mutually orthogonal such that From the distributions of channel estimates and estimation
errors,wefurtherformulatethejointuserassociationandQoS
φφφHφφφ = 0, t∈/ Pk, (4) optimizationproblems,whicharethemaingoalsofthispaper.
t k (τp, t k. One can also analyze the UL performance, but we leave this
∈P
for future work due to space limitations.
The received pilot signal Yl CM×τp at BS l can be
∈
expressed as
Y =H P1/2ΦΦΦH +N , (5) B. Downlink Data Transmission Model
l l l
LetusdenoteγDLasthefractionoftheτ τ datasymbols
CwMhe×reτpthiseGτpau×ssKianpnilooitsemwaittrhixinΦΦΦde=pen[φφφd1e,n.t.e.n,tφφφriKes]haanvdinNglth∈e psieornc,ohheenrceenc0e<intγerDvLaltha1taanreduthseednfuomrbDeLrco−pfayDploLadsytmrabnosmlsisis-
distribution (0,σ2 ).Basedonthereceivedpilotsignal(5) ≤
and assuminCgNthat thUeLBS knows the channel statistics, it can γDL(τc−τp).WeassumethateachBSisallowedtotransmitto
eachuserbutsendsadifferentdatasymbolthantheotherBSs.
apply minimum mean square error (MMSE) estimation [27]
Thisisreferredtoasnon-coherentjointtransmission[28]–[30]
toobtaina channelestimateofh asshowninthefollowing
l,k and it is less complicated to implement than coherent joint
lemma.
transmission which requires phase-synchronization between
4
the BSs.1 At BS l, the transmitted signal x is selected as where the SINR, SINR , is given as
l l,k
ρ E hH w 2
K l,k| { l,k l,k}| .
xl = √ρl,twl,tsl,t. (13) L K ρ E hH w 2 l ρ E hH w 2+σ2
Xt=1 i=1t=1 i,t {| i,k i,t| }−i=1 i,k| { i,k i,k}| DL
(16)
P P P
Herethescalardatasymbols ,whichBSlintendstotransmit
l,t
tousert, hasunitpowerE s 2 =1 andρ standsforthe Proof: The proof is given in Appendix A.
l,t l,t
transmitpowerallocatedto{t|hisp|a}rticularuser.Inaddition,the Each user would like to detect all desired signals coming
corresponding linear precoding vector w CM determines from the L BSs, or at least the ones that transmit with non-
l,t
the spatialdirectivityof the signalsentto th∈is user. We notice zero powers. Proposition 1 gives hints to formulate a lower
that user t is associated with BS l if and only if ρ =0, and boundontheDLergodicsumcapacityofuserk.Wecompute
l,t
each user can be associated with multiple BSs. We w6 ill later this bound by applying the successive decoding technique
optimize the user association and prove that it is optimal to describedin[16],[31].Indetail,theuserfirstdetectsthesignal
only let a small subset of BSs serve each user. The received from BS 1, while the remaining desired signals are treated
signal at an arbitrary user k is modeled as as interference. From the 2nd BS onwards, say BS l, user k
“knows" the transmit signals of the l 1 previous BSs and
−
L L K can partially subtract them from the received signal (using its
yk = √ρi,khHi,kwi,ksi,k+ √ρi,thHi,kwi,tsi,t+nk. statisticalchannelknowledge).Itthenfocusesondetectingthe
Xi=1 Xi=1Xtt==k1 signal sl,k and considers the desired signals from BS l+1 to
6 BS L as interference.By utilizing this successive interference
(14)
cancellation technique, a lower bound on the DL sum SE at
user k is provided in Theorem 1.
The first part in (14) is the superposition of desired signals
thatuser k would like to detect.The second partis multi-user Theorem 1. A lower bound on the DL ergodic sum capacity
interference that degrades the quality of the detected signals. of an arbitrary user k is
The third part is the additive white noise n (0,σ2 ).
k ∼CN DL τ
ToavoidspendingpreciousDLresourcesonpilotsignaling, R =γDL 1 p log (1+SINR ) [bit/symbol], (17)
k − τ 2 k
we suppose that user k does not have any information about (cid:18) c(cid:19)
the current channel realizations but only knows the channel wherethevalueoftheeffectiveSINR,SINR ,isgivenin(18).
k
statistics. This works well in Massive MIMO systems due
to the channel hardening [10]. User k would like to detect Proof: The proof is also given in Appendix A.
all the desired signals coming from the BSs. To achieve low The sum SE expression provided by Theorem 1 has an
computational complexity, we assume that each user detects intuitivestructure.Thenumeratorin(18)isasummationofthe
its different data signals sequentially and applies successive desired signalpowersent to user k overthe average precoded
interference cancellation [16], [31]. Although this heuristic channels from each BS. It confirms that all signal powers are
decoding method is suboptimal since we make practical as- useful to the users and that BS cooperation in the form of
sumptions that the BSs have to do channel estimation and non-coherent joint transmission has the potential to increase
have limited power budget, it is amenable to implement and the sum SE at the users. The first term in the denominator
is known to be optimal for example under perfect channel represents beamforming gain uncertainty, caused by the lack
state information. Suppose that user k is currently detecting of CSI at the terminal, while the second term is multi-user
the signal sent by an arbitrary BS l, say s , and possesses interference and the third term represents the additive noise.
l,k
the detected signals of the l 1 previous BSs but not their Eventhoughweassumeuserkstartstodecodethetransmitted
instantaneouschannelrealizat−ions. From these assumptions, a signal from the BS 1, the BS numbering has no impact on
lower bound on the ergodic capacity between BS l and user SINRk in (18). As a result, the SE is not affected by the
k is given in Proposition 1. decodingorders.Besides,boththelowerboundsinProposition
1 and Theorem 1 are derived independentlyof channel distri-
Proposition 1. If user k knows the signals sent to it by the butionandprecodingschemes.Thus,ourproposedmethodfor
first l 1 BSs in the network, then a lower bound on the DL non-coherentjoint transmission in Massive MIMO systems is
−
ergodic capacity between BS l and user k is applicableforgeneralscenarioswithanychanneldistribution,
any selection of precoding schemes, and any pilot allocation.
R =γDL 1 τp log (1+SINR ) [bit/symbol], Next,weshowthattheexpressionscanbecomputedinclosed
l,k − τ 2 l,k form under Rayleigh fading channels, if the BSs utilize MRT
(cid:18) c(cid:19) (15)
or ZF precoding techniques.
1This paper investigates whether or not joint transmission can bring sub-
C. Achievable Spectral Efficiency under Rayleigh Fading
stantial performance improvements to Massive MIMO under ideal backhaul
conditions. Note that non-coherent joint transmission requires no extensive
We now assume that the BSs use either MRT or ZF to
backhaul signaling, since the BSs send separate data streams and do not
requireanyinstantaneous channel knowledge fromothercells. precodepayloaddata beforetransmission.Similar to [32],the
5
L
ρ E hH w 2
i,k| { i,k i,k}|
SINR = i=1 . (18)
k L P L K
ρ (E hH w 2 E hH w 2)+ ρ E hH w 2 +σ2
i,k {| i,k i,k| }−| { i,k i,k}| i,t {| i,k i,t| } DL
i=1 i=1t=1
P PtP6=k
precoding vectors are described as Corollary 2. For Rayleigh fading channels, if the BSs utilize
ZF precoding, then the lower bound on the DL ergodic sum
hˆ
l,k , for MRT, capacity in Theorem 1 is simplified to
wl,k =√E{Hkˆhˆlr,kk2} (19) τ
√E{kHˆlllr,lk,kk2}, for ZF, RkZF =γDL(cid:18)1− τpc(cid:19)log2 1+SINRZkF [bit/symbo(l2],3)
where rl,k is the kthcolumn of matrix (HHl Hl)−1. From the where the SINR, SINRZkF, is (cid:0) (cid:1)
above definition, with the condition M > K, ZF precoding
L
could cancel out interference towards usbersbthat BS l is not (M K) ρ θ
i,k i,k
associatedwith;thisprecodingwascalledfull-pilotZFin[32]. − i=1 .
2.Mathematically,ZFprecodingyieldsthefollowingproperty L PL K
(M K) ρ θ + ρ (β θ )+σ2
− i,t i,k i,t i,k− i,k DL
hˆHl,twˆl,k =0β,l,k√p√kEp{tkβHlb,tlrl,kk2}, tt∈∈/ PPkk,. (20) Proof:iP=T1hte∈PpPkr\o{okf}is given iniP=A1ptPp=e1ndix C. (24)
The benefits of the array gain, BS non-coherent joint
The lower boundonthe ergodicSE in Theorem1 is obtained transmission, and pilot contamination effects shown by MRT
in closed forms for MRT and ZF precoding as shown in
are also inherited by ZF. The main distinction is that MRT
Corollaries 1 and 2.
precoding only aims to maximize the signal-to-noise (SNR)
Corollary 1. For Rayleigh fading channels, if the BSs utilize ratio but does not pay attention to the multi-user interference.
MRT precoding,thenthe lowerboundonthe DL ergodicsum Meanwhile, ZF sacrifices some of the array gain to mitigate
rate in Theorem 1 is simplified to multi-user interference. The DL SE is limited by pilot con-
tamination and the advantages of using mutually orthogonal
RMRT =γDL 1 τp log 1+SINRMRT [bit/symbol], pilot sequences are shown in Remark 1.
k − τ 2 k
(cid:18) c(cid:19) (21) Remark1. WhenthenumberofBSantennasM andthe
(cid:0) (cid:1) →∞
where the SINR, SINRMRT, is number of users K is fixed, the SINR values in (22) for MRT
k and (24) for ZF converge to PLi=1ρi,kθi,k meaning
M L ρ θ thatthegainofaddingmoreaPnteLi=n1nPast∈dPimk\i{nki}sρhie,tsθ.iI,kncontrast,
i,k i,k
i=1 . (22) if the users utilize mutually orthogonal pilot sequences, i.e.,
L P L K
M ρ θ + ρ β +σ2 τp K,thenaddingupmoreBSantennasisalwaysbeneficial
i=1t∈Pk\{k} i,t i,k i=1t=1 i,t i,k DL sinc≥e the SINR value of user k is given for MRT and ZF as
P P P P
Proof: The proof is given in Appendix B. M L ρi,kpkτpβi2,k
This corollary reveals the merits of MRT precoding for SINRMRT = i=1pkτpβi,k+σU2L , (25)
k L KP
multi-cell Massive MIMO DL systems: The signal power in- ρ β +σ2
i,t i,k DL
creasesproportionallyto M thankstothe arraygain.Thefirst i=1t=1
P P
term in the denominator is pilot contamination that increases (M K) L ρi,kpkτpβi2,k
swppcirhlhooeeptndourrMteliiuonsng→ealilniy∞nd[t3oe[x43M]3,s]e[.at3Wn5Pd]e,km,caalasfnkooersssitgerthexnseaifismactcpahhnlaeittelyvathaibepnlrceosrpoerea-acrtselaeyllsθeasdetulerpcaaittlneeodddt SINRZkF = i=L1tK=−1pkρτi,piPt=ββi1i,,kkp+σkU2στpLU2βLi,+k+σσU2D2LL. (26)
i,k
therebyincreasetheSINR.Incontrast,theregularinterference Note that for both MPRTPand ZF precoding,the DL ergodic
is unaffectedby the numberof BS antennas. Finally, the non- SE not only dependson the channelestimation quality which
coherentcombinationofreceivedsignalsatuserk addsupthe can be improved by optimizing the pilot powers but also
powers from multiple BSs and can give stronger signal gain heavily depends on the power allocation at the BSs; that
than if only one BS serves the user. is, how the transmit powers ρ are selected. In this paper,
i,t
we only focus on the DL transmission, so Sections III to V
investigate different ways to jointly optimize the DL power
2TheZFprecodingwhichweareusinghereisdifferentfromtheclassical
allocation and user association with the predetermined pilot
one[7].Moreprecisely,theclassicalZFprecodingdedicatedtoBSlcanonly
cancel outinterference towards totheusersthatareassociated withthisBS. power.
6
III. DOWNLINKTRANSMIT POWEROPTIMIZATION FOR Lemma3. IfthesystemutilizesZFprecoding,thenthepower
MASSIVE MIMO SYSTEMS minimization problem in (30) is expressed as
ThetransmitpoweratBS idependsonthe trafficloadover
the coverage area and is limited by the peak radio frequency L K
output power Pmax,i, which defines the maximum power that minimize ∆i ρi,t
can be utilized at each BS [26]. The transmit power Ptrans,i {ρi,t≥0} Xi=1 Xt=1
is computed as L
G ρ θ
i,k i,k
K K subject to i=1
P =E x 2 = ρ E w 2 = ρ . (27) L PL K
trans,i {k ik } i,t {k i,tk } i,t G ρ θ + ρ (β θ )+σ2
t=1 t=1 i,t i,k i,t i,k− i,k DL
X X i=1 t i=1t=1
The transmitpower consumptionat BS i that takes the power PPkP\∈{k} P P
amplifier efficiency ∆ into account is modeled as ξˆ , k
i k
≥ ∀
P =∆ P , 0 P P . (28) K
i i trans,i trans,i max,i
≤ ≤ ρ P , i,
i,t max,i
Here, ∆ depends on the BS technology [36] and affects the ≤ ∀
i t=1
power allocation and user association problems. Specifically, X (32)
the values ∆ may not be the same, for example, the BSs are where G=M K.
i −
equipped with the different hardware quality.
The optimal power allocation and user association are
The main goal of a Massive MIMO network is to deliver
obtained by solving these problems. At the optimal solution,
a promised QoS to the users, while consuming as little
each user t in the network is associated with the subset of
power as possible. In this paper, we formulate it as a power
BSs that is determined by the non-zero values ρ , i,t. The
minimization problem under user-specific SE constraints as i,t ∀
BS-user association problem is thus solved implicitly. There
L are fundamentaldifferencesbetween ourproblemformulation
minimize P
i and the previous ones that appeared in [12], [13], [16] for
{ρi,t≥0} Xi=1 (29) conventionalMIMO systems with a few antennas at the BSs.
subject to Rk ξk, k The main distinction is that these previous works consider
≥ ∀
P P , i, short-term QoS constraints that depend on the current fading
trans,i max,i
≤ ∀
realizations,whileweconsiderlong-termQoSconstraintsthat
where ξ is the targetQoS at user k. Plugging(17), (27), and
k
do not depend on instantaneous fading realizations thanks
(28) into (29), the optimization problem is converted to
to channel hardening and favorable properties in Massive
L K
MIMO.Inaddition,ourproposedapproachismorepractically
minimize ∆ ρ
i i,t appealing since the power allocation and BS-user association
{ρi,t≥0} Xi=1 Xt=1 (30) can be solved over a longer time and frequency horizons and
subject to SINR ξˆ , k
k k since we do not try to combat small-scale and frequency-
≥ ∀
Ptrans,i Pmax,i , i, selective fading by the power control.
≤ ∀
where ξˆk = 2γDLξ(kτcτc−τp) 1 implies that the QoS targets are
transformed into SINR t−argets. Owing to the universality of IV. OPTIMAL POWERALLOCATIONAND USER
SINR , (30) is a general formulation for any selection of ASSOCIATION BY LINEARPROGRAMMING
k
{ }
precodingscheme.We focusonMRT andZFprecodingsince
wehavederivedclosed-formexpressionsforthecorresponding This section provides a unified mechanism to obtain the
SINRs. In these cases, the exact problem formulations are optimal solution to the total power minimization problem
provided in Lemmas 2 and 3. for both MRT and ZF precoding. The BS-user association
principleisalsodiscussedbyutilizingLagrangedualitytheory.
Lemma 2. If the system utilizes MRT precoding, then the
power minimization problem in (30) is expressed as
L K A. Optimal Solution with Linear Programming
minimize ∆ ρ
i i,t
{ρi,t≥0} Xi=1 Xt=1 We now show how to obtain optimal solutions for the
M L ρ θ problemsstated in Lemmas 2 and 3. Let us denote the power
subject to i=1 i,k i,k controlvectorofanarbitraryusertbyρρρ =[ρ ,...,ρ ]T
L L K t 1,t L,t
MξiˆP=1,t∈kPPk\{k}ρi,tPθi,k+iP=1tP=1ρi,tβi,k+σD2L CWzeLero,awelsnhoteridreeesnibotsutetet∆∆∆nhter=ieitsh[∆soa1ntie.s.fiy.s∆1ρL.i,T]tTh≥e∈o0CptLmimeaaannldipnǫǫǫogiw∈tehrCaatLlρρlρohtcaa(cid:23)stiao0∈lnl.
k
≥ ∀
K is obtained by the following theorem.
ρ P , i.
i,t max,i
≤ ∀ Theorem 2. The optimal solution to the total transmit power
t=1
X (31) minimization problem in (30) for MRT or ZF precoding is
7
obtained by solving the linear program where the non-negative Lagrange multipliers λ and µ are
k i
associatedwiththekthQoSconstraintandthetransmitpower
K
minimize ∆∆∆Tρρρ constraint at BS i, respectively. The corresponding Lagrange
t
{ρρρt(cid:23)0} Xt=1 dual function of (34) is formulated as
K
subject to θθθTkρρρt+ cTkρρρt−bTkρρρk+σD2L ≤0, ∀k G(λk,µi)={iρρρntf}L(ρρρt,λk,µi)
t∈PXk\{k} Xt=1 K L K (35)
K = λ σ2 µ P + inf aTρρρ ,
ǫǫǫTi ρρρt ≤Pmax,i, ∀i. Xk=1 k DL−Xi=1 i max,i {ρρρt} Xt=1 t t
t=1
X (33) whereaT =∆∆∆T + K λ θθθT (t)+ K λ cT λ bT+
sHcehreem,et.heMRveTctporrescoθθθdki,ncgk,giavensd bk depend on the precoding Li=1µitǫǫǫTi and thePinkd=ic1atokrkfu1nkction 1Pk(kt=)1iskdekfin−edtast
θθθk =[Mθ1,k,...,MθL,k]T P k(t)= 0, t∈/ Pk\{k}, (36)
c =[β ,...,β ]T , 1 (1, t∈Pk\{k}.
k 1,k L,k
T It is straightforward to show that (λ ,µ ) is bounded from
b = Mθ /ξˆ ,...,Mθ /ξˆ , G k i
k 1,k k L,k k below (i.e, (λ ,µ ) = ) if and only if a 0, for t =
k i t
G 6 −∞ (cid:23)
while ZF precodinhg obtains i 1,...,K. Therefore, the Lagrange dual problem to (33) is
θθθk =[(M K)θ1,k,...,(M K)θL,k]T K L
ck =[β1,k−−θ1,k,...,βL,k−−θL,k]T , m{aλxki,mµii}ze k=1λkσD2L−i=1µiPmax,i (37)
T X X
bk = (M −K)θ1,k/ξˆk,...,(M −K)θL,k/ξˆk . subject to at (cid:23)0, ∀t.
Proof:hThe problem in (33) is obtained from Leimmas 2 From this dual problem, we obtain the following main result
and 3 aftersome algebra.We notethatthe objectivefunction that gives the set of BSs serving an arbitrary user t.
is a linear combinationofρρρt, for t=1,...,K. Moreover,the Theorem 3. Let λˇ ,µˇ denotethe optimalLagrangemulti-
constraint functions are affine functions of power variables. { k i}
pliers. User t is served only by the subset of BSs with indices
Thus the optimization problem (33) is a linear program.
in the set defined as
The merits of Theorem 2 are twofold: It indicates that the St
total transmit power minimization problem for a multi-cell K K L
1
Massive MIMO system with non-coherent joint transmission argmin ∆i+ λˇkθi,k k(t)+ λˇkci,k+ µˇi ,
is linear and thus can be solved to global optimality in i k=1 1 k=1 i=1 !bi,t
X X X (38)
polynomial time, for example, using general-purpose imple-
where the parameters c and b are selected by the linear
mentations of interior-point methods such as CVX [37]. 3 In i,k i,t
precoding scheme:
addition,thesolutionprovidestheoptimalBS-userassociation
in the system. We furtherstudy it via Lagrangedualitytheory
Precoding scheme c b
in the next subsection. i,k i,t
MRT β Mθ /ξˆ
i,k i,t t
B. BS-User Association Principle ZF βi,k θi,k (M K)θi,t/ξˆt
− −
To shed light on the optimal BS-user association provided
The optimal BS association for user t is further specified as
bythesolutioninTheorem2,weanalyzetheproblemutilizing
one of the following two cases:
Lagrange duality theory. The Lagrangian of (33) is
It is served by one BS if the set in (38) only contains
K • St
(ρρρ ,λ ,µ )= ∆∆∆Tρρρ one index.
t k i t
L ItisservedbymultipleofBSsiftheset in(38)contains
Xt=1 • several indices. St
K K
+ λk θθθTkρρρt+ cTkρρρt−bTkρρρk+σD2L Proof: The proof is given in Appendix D.
Xk=1 t∈PXk\{k} Xt=1 The expression in (38) explicitly shows that the optimal
L K BS-user association is affected by many factors such as
+ µi ǫǫǫTi ρρρt−Pmax,i!, interference between BSs, noise intensity level, power allo-
i=1 t=1 cation, large-scale fading, channel estimation quality, pilot
X X
(34)
contamination, and QoS constraints. There is no simple user
association rule since the function depends on the Lagrange
3Thelinear program in(33)isonlyobtained fornon-coherent joint trans-
mission.ForthecorrespondingsystemthatdeploysanotherCoMPtechnique multipliers, but we can be sure that max-SNR association is
calledcoherentjointtransmission,thetotaltransmitpoweroptimizationwith not always optimal. We will later show numerically that for
Rayleigh fading channels and MRTorZFprecoding is asecond-order cone
RayleighfadingchannelsandMRTorZF,eachuserisusually
program (see Appendix F). This problem is considered in Section VI for
comparisonreasons. served by only one BS at the optimal point.
8
V. MAX-MIN QOSOPTIMIZATION θ
MRT min 1 log (1+M)
Thissectionisinspiredbythefactthatthereisnotalwaysa k wk 2
feasiblesolutiontothepowerminimizationproblemwithfixed ZF min 1 log 1+(M K)pkτp L β
QoS constraints in (33). The reason is the trade-off between k wk 2(cid:18) − σU2L i=1 i,k(cid:19)
the target QoS constraints and the propagation environments. P
The path loss is one critical factor, while limited power for
Proof: The proof is given in Appendix E.
pilot sequences leads to that channel estimation error always
exists. Thus, for a certain network, it is not easy to select the
Algorithm 1 Max-min QoS based on the bisection method
target QoS values. In order to find appropriate QoS targets,
Result: Solve optimization in (39).
we consider a method to optimize the QoS constraints along
Input: Initialupperboundξupper, andline-searchaccuracyδ;
with the power allocation. 0
Set ξlower =0; ξupper =ξupper;
Fairnessisanimportantconsiderationwhendesigningwire- 0
while ξupper ξlower >δ do
lesscommunicationsystemstoprovideuniformlygreatservice −
Set ξcandidate =(ξupper+ξlower)/2;
for everyone[38]. The vision is to providea goodtarget QoS
if (33) is infeasible for ξ =w ξcandidate, k, then
toallusersbymaximizingthelowestQoSvalue,possiblywith k k ∀
Set ξupper =ξcandidate;
some user specific weighting. For this purpose, we consider
else
the optimization problem
Set ρρρlower as the solution to (33);
maximizemin Rk/wk Set ξ{lokwer =}ξcandidate ;
{ρi,t≥0} k (39) end if
subject to P P , i,
trans,i ≤ max,i ∀ end while
where w > 0 is the weight for user k. The weights can Set ξlower =ξlower and ξupper =ξupper;
k final final
be assigned based on for example information about the Output: Final interval [ξlower,ξupper] and ρρρ˜ = ρρρlower ;
propagation, interference situation or user priorities. If there final final { k} { k }
is no such explicit priorities, they may be set to 1. To solve
From Theorem4, the problem (41) is solved in an iterative
(39), it is converted to the epigraph form [39]
manner. By iteratively reducing the search range and solv-
maximize ξ ing the problem (33), the maximum QoS level and optimal
{ρi,t≥0},ξ BS-user association can be obtained. One such line search
(40)
subject to Rk/wk ξ , k procedure is the well-known bisection method [15], [39]. At
≥ ∀
P P , i, each iteration, the feasibility of (33) is verified for a value
trans,i max,i
≤ ∀
ξcandidate , that is defined as the middle point of the cur-
where ξ is the minimum QoS parameter for the users that we ∈R
rentsearchrange.If(33)isfeasible,thenitssolution ρρρlower
aim to maximize. Plugging (17)and (27) into (40), we obtain { k }
is assigned to as the current power allocation. Otherwise, if
the problem is infeasible, then a new upper bound is set up.
maximize ξ
The search range reduces by half after each iteration, since
{ρi,t≥0},ξ either its lower or upper bound is assigned to ξcandidate. The
subject to SINRk ≥2ξwk/(γDL(1−τp/τc))−1,∀k (41) algorithm is terminated when the gap between these bounds
K is smaller than a line-search accuracy value δ. The proposed
ρi,t Pmax,i, i. max-min QoS optimization is summarized in Algorithm 1.
≤ ∀
Xt=1 We stress that the bisection method can efficiently find the
We can solve (41) for a fixed ξ as a linear program, using solution to quasi-linear programssuch as (41). The main cost
Theorem 2 with ξ = ξw . Since the QoS constraints are for each iteration is to solve the linear program (33) that
k k
increasing functions of ξ, the solution to the max-min QoS includes KL variables and 2K constraints and as such it has
optimization problem is obtained by doing a line search over the complexity (K3L3) [39]. It is important to note that
O
ξ to get the maximal feasible value. Hence, this is a quasi- the computationalcomplexitydoesnotdependon the number
linear program. As a result, we further apply Lemma 2.9 and of BS antennas. Moreover, the number of iterations needed
Theorem 2.10 in [15] to obtain the solution as follows. for the bisection method is log (ξupper/δ) that is directly
proportional to the logarithm⌈ o2f t0he initi⌉al value ξupper,
Theorem 4. The optimumto (41)is obtainedby checkingthe 0
fwehaesirbeilξituyppoefr i(s33s)eloevceterdatnoSmEakseea(r3c3h) rinafnegaesibRle.= [0,ξ0upper], fwohreξre0upp⌈·e⌉r siuscthheascieniliCngorofullnacrytio3n.wTilhlursedaucperothpeertosteallecctoiostn.
0 In summary, the polynomial complexity of Algorithm 1 is
Corollary3. IfthesystemdeploysMRTorZFprecoding,then log ξ0upper K3L3 .
ξupper can be selected as O 2 δ
0 (cid:16)l (cid:16) (cid:17)m (cid:17)
τ VI. NUMERICAL RESULTS
ξupper =γDL 1 p θ. (42)
0 − τ Inthissection,theanalyticalcontributionsfromtheprevious
(cid:18) c(cid:19)
sections are evaluated by simulation results for a multi-cell
The parameter θ depends on the precoding scheme:
Massive MIMO system. Our system comprises 4 BSs and K
9
50
MRT, Optimal
45
MRT, max−SNR
W]40 ZF, Optimal
wer [35 ZF, max−SNR
o
mit p30
ns25
a
al tr20
ot
T15
10
55 0 100 150 200 250 300
Number of antennas per BS
Fig. 3. The total transmit power (PLi=1Pi) versus the number of BS
antennas withQoSof1bit/symbol andK=20.
Fig.2. Themulti-cellmassiveMIMOsystemconsideredinthesimulations: power ( L P ) as a function of the number of antennas
The BS locations are fixed at the corners of a square, while K users are i=1 i
per BS in Fig. 3 for a Massive MIMO system with 20 users.
randomlydistributed overthejointcoverage oftheBSs. P
Forfaircomparison,theresultsareaveragedoverthesolutions
thatmakeboththeassociationschemesfeasible.Experimental
results reveal a superior reduction of the total transmit power
users, as shown in Fig. 2, where (x,y) representlocation in a
compared to the peak value, say 160 W, in current wireless
Cartesian coordinate system. The symmetric BS deployment
networks.Therefore,Massive MIMO can bring greattransmit
makes it easy to visualize the optimal user association rule.
power reduction by itself. A system equipped with few BS
The users are uniformly and randomly distributed over the
antennas consumes much more transmit power to provide the
jointcoverageoftheBSsbutnouserisclosertotheBSsthan
same target QoS level compared to the corresponding one
100 m to avoid overly large SNRs at cell-center users [4].
with a large BS antenna number. The 40 45 W that are
For the max-minQoSalgorithm,the user specific weightsare
−
required with 50 BS antennas reduces dramatically to 5 W
set to w = 1, k, to make it easy to interpret the results.
k
∀ with 300 BS antennas. This is due to the array gain from
Since the joint power allocation and user association obtains
coherentprecoding.Inaddition,thegapbetweenMRTandZF
the optimal subset of BSs that serves each user, we denote
isshortenedby thenumberofBS antennas,since interference
it by “Optimal" in the figures. For comparison, we consider
ismitigatedmoreefficiently[10],[17].Fromtheexperimental
a suboptimal method, in which each user is associated with
results,wenoticethatthesimplemax-SNRassociationisclose
only one BS by selecting the strongest signal on the average
(i.e.,themax-SNRvalue).4 Theperformanceisaveragedover to optimal in these cases.
differentrandomuserlocations.ThepeakradiofrequencyDL Fig.4plotsthetotaltransmitpowertoobtainvarioustarget
output power is 40 W. The system bandwidth is 20 MHz QoS levels at the 20 users. As discussed in Section II-C,
and the coherence interval is of 200 symbols. We set the MRT precoding works well in the low QoS regime where
power amplifier efficiency to 1 since it does not affect the noise dominates the system performance,while ZF precoding
optimizationwhenallBSshavethesamevalue.Theuserssend consumes less power when higher QoS is required. In the
orthogonalpilotsequenceswhoselengthequalsthenumberof lowQoSregime,ZFandMRT precodingdemandroughlythe
users and each user has a pilot symbol power of 200 mW. 5 same transmit power. For instance, with the optimal BS-user
Because we focus on the DL transmission, the DL fraction association and QoS = 1 bit/symbol, the system requires the
is γDL = 1. The large scale fading coefficients are modeled total transmit power of 8.88 W and 9.60 W for MRT and ZF
similarlytothe3GPPLTEstandard[26],[40].Specifically,the precoding,respectively.In contrast, at a high targetQoS level
shadow fading z is generated from a log-normal Gaussian such as 2.5 bit/symbol, by deloying ZF rather than MRT, the
l,k
distribution with standard deviation 7 dB. The path loss at system saves transmit power up to 2.39 W. Similar trends are
distance d km is 148.1+37.6log d. Thus, the large-scale observedforthemax-SNRassociation.Becausethenumerical
10
fadingβ iscomputedbyβ = 148.1 37.6log d+z resultsmanifestsuperiorpowerreductionincomparisontothe
dB. Withl,kthe noise figure ofl5,kdB,−the nois−e variance10for bolt,kh small-scaleMIMOsystems,MassiveMIMOsystemsarewell-
the UL and DL is 96 dBm. We show the total transmit suited for reducing transmit power in 5G networks.
−
While optimal user association and max-SNR association
4For comparison purposes, the best benchmark is the method that also givesimilarresultsinthepreviousfigures,westressthatthese
performstheoptimalassociationbutwithservicefromonlyoneBS.However, only considered scenarios when both schemes gave feasible
it is a combinatorial problem followed by the excessive computational
results.Themaindifferenceisthatsometimesonlytheformer
complexity. Furthermore, the numerical results verify that the max-SNR
association is a good benchmark for comparison since the performance is can satisfy the QoSconstraints. Fig. 5 andFig. 6 demonstrate
veryclosetotheoptimal association. the“badserviceprobability"definedasthefractionofrandom
5In most cases in practice, appropriate non-universal pilot reuse renders
user locations and shadow fading realizations in which the
pilotcontaminationnegligible.Hence,weonlyconsiderthecaseoforthogonal
pilotsequences inthis section. Wealsoassumeτp=K. power minimization problem is infeasible. Note that these
10
50 100
45
40
W] y
er [35 bilit10−1
w a
mit po2350 e prob
ns vic
Total tra1250 MMRRTT,, Ompatxim−SaNlR Bad ser10−2 MMRRTT,, Ompatxim−SaNlR
10
ZF, Optimal ZF, Optimal
5
ZF, max−SNR ZF, max−SNR
00. 5 1 1.5 2 2.5 10−31 1.5 2 2.5
QoS constraint per user [bit/symbol] QoS constraint per user [bit/symbol]
Fig. 4. The total transmit power (PLi=1Pi) versus the target QoS for Fig.6. Thebadserviceprobability versustheQoSconstraintperuserwith
M =201000,K=20. M =200,K=20.
1
F)0.9 Optimal
D
C
ability10−1 ction (00..78 max−SNR
e prob on fun0.6 ZF, M=150 MRT, M=300
Bad servic10−2 MMRRTT,, Ompatxim−SaNlR ve distributi000...345
ZF, Optimal ulati0.2
m
ZF, max−SNR Cu0.1
10−53 0 Number of an10te0nnas per BS 150 00 0.5 1 1.5 2 2.5 3 3.5 4
QoS (bit/symbol)
Fig.5. Thebadserviceprobability versusthenumberofBSantennas with
Fig. 7. The cumulative distribution function (CDF) of the max-min QoS
QoSof1bit/symbol andK=20.
optimization withK=20.
figuresjustdisplaysomerangesoftheBSantennasortheQoS
constraintswherethedifferencesbetweentheuserassociations also provide the average max-min QoS levels when the sys-
are particularly large. Intuitively, the optimal user association tem deploys the DL coherent joint transmission denoted as
is more robust to environment variations than the max-SNR “Optimal (Coherent)" in the figure. The procedures to obtain
association,sincethenon-coherentjointtransmissioncanhelp closed-form expressionsas well as the optimization problems
to resolve the infeasibility. In addition, the two figures also for the DL coherent joint transmission are briefly presented
verify the difficulties in providing the high QoS. Specifically, in Appendix F. On average, this technique can bring a gain
averyhighinfeasibilityuptoabout80%isobservedwhenthe up to 5% compared to “Optimal" but it is more complicated
BSshaveasmallnumberofantennasortheusersdemandhigh to implement as discussed in Section II-B. By deploying
QoS levels. This is a key motivation to consider the max-min massive antennas at the BSs, the numerical results manifest
QoSoptimizationprobleminstead,becauseitprovidesfeasible the competitiveness of the max-SNR association versus the
solutions for any user locations and channel realizations. “Optimal"ones.ThereasonisthatthemultipleBScooperation
Fig. 7 shows the cumulative distribution function (CDF) of increases not only the array gain (in the numerator) but
the max-min optimized QoS level, where the randomness is unfortunately also mutual interference (in the denominator)
duetoshadowfadinganddifferentuserlocations.Weconsider of the SINR expressions as shown in Corollaries 1 and 2 for
150 BS antennas for ZF precoding or 300 BS antennas for non-coherent joint transmission or in (74) for coherent joint
MRTprecodingtoavoidoverlappingcurves.Theoptimaluser transmission.Itisonlyafewusersthatgainfromnon-coherent
association gives consistently better QoS than the max-SNR joint transmission and the added benefit from coherent joint
association. The system model equipped with 300 antennas transmission is also small.
per BS can provide SE greater than 2 bit/symbol for every Fig. 9 considersthe same setup as Fig. 8 butwith 40 users.
user terminal in its coverage area with high probability. The Here, the max-min QoS reduces due to more interference,
QoScanevenreachupto4bit/symbol.Moreover,theoptimal while the gain from joint transmission is still small. When
association gains up to 22% compared with the max-SNR the numberof antennasper BS is not significantly largerthan
association at 95%-likely max-min QoS. thenumberusers,MRT outperformsZFbecauseZFsacrifices
The average max-min QoS levels that the system can some of the array gain to reduce interference. Fig. 8 and
provide to the all users is illustrated in Fig. 8 for 20 users. Fig. 9 also show that, for example, a system with 200 BS
The optimal BS-user association provides up to 11% higher antennas and using non-coherentjoint transmission can serve
QoS than the max-SNR association. For completeness, we up to 20 users and 40 users for the QoS requirement of 2.28