Table Of ContentMon.Not.R.Astron.Soc.000,000–000 (0000) Printed26January2009 (MNLATEXstylefilev2.2)
An Interference Removal Technique
for Radio Pulsar Searches
9
0 R. P. Eatough1⋆, E. F. Keane1, A. G. Lyne1
0 1 Jodrell Bank Centre for Astrophysics, Alan Turing Building, Universityof Manchester, Manchester, M13 9PL, United Kingdom.
2
n
a 1May2008
J
6
2 ABSTRACT
Searches for radio pulsars are becoming increasingly difficult because of a rise in im-
] pulsiveman-madeterrestrialradio-frequencyinterference.Herewepresentanewtech-
A
nique, zero-DM filtering, which can significantly reduce the effects of such signals in
G
pulsar search data. The technique has already been applied to a small portion of the
. data fromthe Parkesmulti-beampulsar survey,resulting inthe discoveryoffour new
h
pulsars, so illustrating its efficacy.
p
-
Key words: methods: data analysis - pulsars: general - stars: neutron
o
r
t
s
a
[
1 INTRODUCTION 2 ZERO-DM FILTERING
1
v Pulsarsearchdataareoftencorruptedbythepresenceofim- A fundamental characteristic of broadband pulsar signals
3 pulsive, broadband and sometimes periodic terrestrial radi- is the frequency-dependent dispersion of their pulse arrival
9 ation. Such radio frequency interference (RFI) originates in timesas a result of traversing theionised component of the
9 unshielded electrical equipment which produces discharges, interstellar medium.Pulses observed at lower frequency ar-
3 such as automobile ignition systems, electric motors, and rivelaterthantheirhigher-frequencycounterparts.Thede-
1. fluorescent lighting, as well as discharge from high-voltage lay,t, at radio frequency f (MHz) is given by:
0 power transmission lines. It may also arise naturally from
DM
9 the radio emission generated in lightning discharges. Such t=4150 sec, (1)
„ f2 «
0 RFI can often be very strong and can even enter receiver
: systemsthroughthefar-outsidelobesofthetelescoperecep- whereDMisthedispersion measure, theintegratedcolumn
v
tionpattern.Severalmethodshavebeenemployedtoreduce densityoffreeelectrons along thelineofsight,measured in
i
X theeffectsof RFI,suchasclippingintensespikes,removing cm−3pc(e.g.Lyne&Smith2006).Detectingapulsewitha
r parts of the fluctuation spectrum, and identifying common finitebandwidthreceiverresultsinabroadenedpulseprofile
a signals in the different beams of a multi-beam receiver sys- andacorrespondingreductioninpulsesignal-to-noiseratio.
tem.Theseproceduresallrequirecarefullytunedalgorithms Before any search for pulses can be performed, the data
toremovetheinterference,andatthesametimemustcause have to be compensated for the effects of a number of trial
minimal damage to theastronomical data. values of DM. In order to do this, the bandwidth of the
RFIsignals aremostly broadbandbutgenerally donot receiverisfirstsplitintoanumberofindependentfrequency
display the dispersed signature of radio pulsars. Here, we channels,whichareappropriatelysampledtoproduceatwo-
presentasimplealgorithm whichwecall‘zero-DMfiltering’ dimensional array of samples, S(f,t) at frequency f and
i j i
to selectively remove broadband undispersed signals from time t. Appropriate time delays for a given trial DM are
j
data prior to the application of normal pulsar search algo- thenappliedtoeachfrequencychannelsothatanypulsesat
rithms.Theoutlineofthispaperisasfollows: following the thisDMarealignedintime.Thefrequencychannelsarethen
description of the algorithm in section 2, in section 3 we summed together to produce a time series of dedispersed
show that the procedure does indeed remove much of the data, x(t).
interference in typical observing situations and in general The zero-DM filter is implemented prior to the dedis-
greatly improves the visibility of celestial dispersed pulses. persion described above, by simply calculating the mean of
In section 4 we present four new pulsars discovered in the all frequency channels in each time sample and subtracting
Parkesmulti-beampulsarsurvey(PMPS)afterapplyingthe thisfromeachindividualfrequencychannelinthetimesam-
new technique. Finally section 5 is a discussion of the ben- ple. Hence the adjusted values of the samples, S′(f,t) are
i j
efits and limitations of theprocedure. calculated as:
′ 1 nchans
S(f,t)=S(f,t) S(f,t). (2)
⋆ E-mail:[email protected] i j i j − nchans Xi=1 i j
f
a)
B
f
0
f t
b)
B
f
0
t Figure 2.Thepulsedistortioncaused byzero-DMfilteronide-
Bdt/df alised box-car pulses of varying width for the PMPS observing
w(t) system.ThetimescaleshouldbemultipliedbytheDMincm−3pc
c) togivethetimeinmilliseconds.
t
Figure1.Theeffectofthethezero-DMfilteronanidealisednar-
row linearly-dispersed pulse in the frequency-time domain. The
toppanel(a)showsthedispersiondriftofthepulseBdt/df over
thefullbandwidth Bofthereceiver. Subtractionof themean in
verticalstripstoremovezero-DMsignals(Equation2)leavesthe
non-pulse area (shaded grey) negative. Panel (b) shows the re-
sultofdedispersingthedata atthecorrectvalueofDMandthe
lower panel (c) shows the resultant pulse shape after adding all
thefrequencychannels together.
Clearly,anybroadbandundispersedsignalwillresultin
asimultaneousriseacrossallfrequencychannelsandwillbe Figure 3. Two example effective zero-DM filters for
removedbythisprocess.Wenowinvestigatetheeffectofthis DM=500 cm−3pc and DM=100 cm−3pc for the PMPS,
procedureondispersedcosmicpulses.Consideranidealised showing variation in relative spectral amplitude with the
dispersedpulsarsignalwithverynarrowpulsesandapprox- fluctuationfrequency.
imatethedispersiondriftacrossthefullreceiverbandwidth
Btoalinearslope,dt/df,whichisgivenapproximatelyby:
In the frequency domain, equivalently, the fluctuation
dt DM
= 8300 sec/MHz, (3) spectrumofthededispersedtimesseriesismultipliedbythe
df − „f 3 «
0 Fouriertransform, W(ν),ofw(t) which canbeshown tobe
wheref (MHz)isthecentralobservingfrequency.Figure1a of theform:
0
showssuchapulsesweepingthroughthefrequencybandofa dt
W(ν)=1 sinc2(πB ν)
receiver,traversingthefullbandwidthinatimeofBdt/df. − df
Aftersubtractionofthemeaninverticalstripsasdescribed (4)
8300πBDM
by Equation 2, the non-pulse grey area in the Figure 1a =1 sinc2 ν ,
− „ f3 «
is negative. Dedispersion then distorts this pattern in the 0
manner shown in Figure 1b, so that adding vertically after where ν is the fluctuation frequency of the signal. Figure 3
the dedispersion then gives the convolving function, w(t) shows the effect of the zero-DM filter on the spectral am-
showninFigure1c.Notethenegativetriangularareawhich plitudeofapulseattwospecifiedDM’sforPMPS-styleob-
is adjacent to, and equals the area of, the pulse. Thus the servations. The zero-DM process effectively acts as a high-
zero-DM process results in the dedispersed time series x(t) passfilteronthedispersedpulse.The‘low-frequencycutoff’,
being convolved by this function, w(t). Of course any real ν canbeshownusingEquation4tolieatafluctuation
cutoff
celestial pulse will have a finite width. In Figure 2 we show frequency 500/DMHz.ThusforDM=100cm−3pc,allfre-
∼
the effects of the zero-DM filter on idealised box-car pulses quencies<5Hzwillbelost.Thereductioninamplitudeand
of different widths for the PMPS observing system at 1.4 pulse distortion we see in Figure 2 can be explained by the
GHz (Manchester et al. 2001). In this case, f =1394 MHz loss of thelow frequency components of the pulseprofile.
0
and B=288 MHz. The pulse width in milliseconds can be For a typical pulsar we measure a regular train of nar-
calculatedbysimplymultiplyingbytheDMincm−3pc.For row pulses, the spectrum of which is a ‘picket fence.’ The
example, at a DM of 100 cm−3pc the bottom pulse would zero-DMfilterwillcutoffallspectralfeaturesbelowν .
cutoff
haveawidthof46ms.Thepeakamplitudeclearlydecreases However,normalpulsarswithpulsewidthsafewpercentof
for pulses with larger widths. their pulse period will usually have most of their power in
spectral harmonics at higher frequencies and these will not
beaffectedsignificantly.Sincestandardpulsarsearchesper-
formharmonicsumming(seee.g.Lyne&Smith2006or,for
a detailed description of pulsar search algorithms, Lorimer
& Kramer 2005), the detrimental effect of the zero-DM fil-
teronthefinalspectralamplitudeisreduced.Assumingthe
pulsar has n P/2W harmonics of equal amplitude where
∼
P is the pulsar period and W is the pulse width, the num-
berofharmonicslostbelowthelow-frequencycutoffisgiven
byn Pν ,theharmonic summing procedurewill
cutoff cutoff
∼
increase the spectral signal-to-noise ratio by a factor of ap-
proximately (n n )1/2.
cutoff
−
The zero-DM process causes apredictable reduction in
the amplitudes of low frequencies of the fluctuation spec-
trum of a dispersed pulsar. It will also reduce the ampli-
tude of any broadband undispersed impulsive signals sub-
stantially,butwillhavelittleeffectuponthermalnoise.The
signal-to-noiseratioofthepulsarcanthereforebeoptimised
by applying an optimum matched filter to the spectrum, Figure4.Thetoppanel(a)showsagreyplotofsimulateddata
of a 130-ms burst of broadband RFI with DM=0 cm−3pc fol-
which reduces the spectral amplitude where the pulsar sig-
lowedbya20-msdispersedpulsewithDM=150cm−3pcacrossa
nal is known to be small because of the zero-DM filtering.
288MHz bandpass centered at 1374 MHz. The middle panel (b)
Thus,thereisasecondsteptothefilteringprocesswhereby
showsthesamedataafterapplicationofthezero-DMfilter.Note
the frequency response of the zero-DM filter is re-applied
the negative non-pulse area. In panel (c), the data have been
aftereachdedispersiontrial.Inthetimedomainthisisbest dedispersed for a DM=150 cm−3pc and summed in frequency
illustrated by considering a single-pulse search (McLaugh- givingthepulseprofile.
lin et al. 2006). Standard single-pulse searches involve con-
volution of the dedispersed time series x(t) with box-cars
b(t) of various widthsand searching for peaks in x(t) b(t),
∗
where denotes convolution. In our case, the zero-DM fil- search examples re-application of the zero-DM filter after
∗ ′
tered time series is x(t) = x(t) w(t), so that a standard each dispersion trial hasnotbeen performed becauseof the
∗ ′
single-pulsesearchlooksforpeaksinx(t) b(t).Asaresult additional computational overheads this would impose in
∗
of zero-DM filtering the optimal filter is now not a box-car oursearchalgorithms (seeSection5forafurtherdiscussion
′
but rather is given by b(t) = b(t) w(t). We now search on this subject).
for peaksin x′′(t)=x′(t) b′(t)= ∗−1[X′(ν) W(ν)] b(t) Figure 5 illustrates clearly the effects of the proce-
∗ F ∗ ∗
where denotes the Fourier transformation and we have dure on a 35-minute PMPS observation in the direction of
F
used the commutability of convolution so the convolution PSR J1842+0257, which has a period of 3.1 seconds and
canbeperformedinthefrequencydomain,whichiswhatis a DM of 148 cm−3pc, so that the zero-DM low-frequency
donepractice. cutoff is at about 3.3 Hz. On the left is the normal search
output,whileontherightisthatwiththezero-DMfiltering
procedure in place. After application of the zero-DM filter
3 EXAMPLES therednoiseandimpulsiveinterferenceisalmostcompletely
removed,andtheexpectedpulsedistortionduetothefilter-
The effects of the zero-DM filter have been investigated ingasshowninFigure1candFigure4cisclear.Remarkably,
using simulated PMPS data generated with the Sigproc- even with such a long-period pulsar, in which the funda-
4.21 pulsar analysis software suite. Figure 4a shows sim- mental and first few harmonics are completely missing, the
ulated data of a 130-ms burst of broadband RFI with absence of the interference makes its detection more secure
DM=0 cm−3pc followed by a 20-ms dispersed pulse with thanpreviously. AnumberofperiodicitysearchesonPMPS
DM=150 cm−3pc across a 288MHz bandpass centered at beamscontainingknownpulsarswitharangeofperiodsand
1374MHz.Figure4bshowsthesamedataafterapplication dispersion measures has been performed. The fluctuation
of the zero-DM filter. The broadband RFI signal has been spectra from the periodicity search are much cleaner than
completelyremovedwithlittleeffectonthedispersedpulse. before (see Figure 6). The‘forest’ of RFI signals at low fre-
Dedispersion at a DM=150 cm−3pc and summation in fre- quency are completely removed by the new technique. The
quency produces the pulse profile shown in Figure 4c. The pulsarspectralsignal-to-noiseratiosbehaveasexpected,but
expected pulse distortion is clearly visible. becauseofthereductionin thenumberofperiodic RFIsig-
We also present examples of the zero-DM filter as ap- nals, the pulsars are easier to detect.
plied to observational data from the PMPS in both peri- Figure7showsexamplesofsingle-pulsesearchdiagnos-
odicity and single-pulse searches. All clipping and zapping ticplotsfromouranalysisofthePMPS.PlottedinFigure7
algorithms used previously formitigating theeffectsof RFI are the time series for each of the 325 trial DM’s (in the
(Hobbs et al. 2004) have been omitted. In our periodicity range0 2200cm−3pc).Eachdetectedsingle-pulseeventis
−
plottedasacirclewithradiusproportionaltosignal-to-noise
ratio.Thetoppanelistheresultofastandardanalysiswith-
1 http://sigproc.sourceforge.net outzero-DMfiltering.Theobservationcontainssinglepulses
1000 11000000
800 880000
time (s) 460000 time (s)time (s) 464600000000
200 220000
0 0.2 0.4 0.6 0.8 1 00 00..22 00..44 00..66 00..88 11
30000 20000
flux (arbitrary units) 1122 505050000000000 000000 flux (arbitrary units) 11- 550500000000 00000
-5000 0 0.2 0.4 0.6 0.8 1 -10000 0 0.2 0.4 0.6 0.8 1
pulse phase pulse phase
Figure 5. The effects of the zero-DM filter on folding PMPS
data from the 3.1-second pulsar, PSR J1842+0257, which has a
DMof148cm−3pc.Theleft-handpanelsaretheresultofusinga
regularanalysis,whiletheright-handpanelsareafterapplication
of the zero-DM filter. On each side, at the top are grey plots of
63 temporal sub-integrations folded at the pulse period, cover-
ingthefull35-minutesurveyobservation,andatthebottomisa
panel showing the full integrated profile. The effect of the filter
on the shape of the pulse profile can be clearly seen. The asym-
metry of the depressions either side of the pulse arise because
the dispersion sweep across the bandpass is not perfectly linear
buthasaquadraticcomponent,althoughinmostcasesthesweep
is well approximated by a linear slope. Note that the impulsive
RFI present through the majority of the observation is almost
completelyremovedandthebaselinewobbleinthefinalprofileis
muchflatter inthefilteredcase.
Figure7.Single-pulsesearchdiagnosticplotsofa35-minuteob-
servation of the erratic pulsar PSR B1735−32. Top: using stan-
dardsearchmethodwithoutzero-DMfilter;Broadbandterrestrial
interference causes the large stripes across a wide range of DM.
Middle: After using zero-DM filter, most RFI streaks have been
removedwithsinglepulsesfromthepulsarnowmuchmorevisible
(at DM channel≈82). Bottom: After using the filter and apply-
ingtheoptimalmatchedfilter.RemnantRFIstreaksarefurther
removedandpulsesfromthepulsarremain.
fromPSRB1735 32atDMchannel=82(DM=50cm−3pc),
−
but we can see that the output is contaminated with many
RFIstreaksmakingidentificationofthepulsardifficult.The
middle panel shows the corresponding plot with zero-DM
filteringapplied. The vast majority of theRFI hasbeen re-
movedbutthepulsarisstillpresent.Obviousalsoareafew
remnant RFI streaks at high DM which have not been re-
moved by the filtering. Searching the time series with the
optimal single-pulse profile, w(t), improves things even fur-
therbyremovingtheremnantstreaksalmostcompletely,as
Figure 6.FluctuationspectrafromaPMPSsurveyobservation can beseen in thelower panel.
inthedirectionofthe0.53-secondpulsar,PSRJ1604-4718,which
hasaDMof52cm−3pc.Thetoppanelshowsthespectrumwith-
outanyzero-DMfiltering,thebottompanelisthesamedataafter 4 DISCOVERY OF FOUR NEW SOURCES
thezero-DMfilterhasbeenapplied.Thearrowsindicatethepo-
sition of the fundamental spin frequency of the pulsar and four The zero-DM filter has been incorporated into a new re-
subsequent harmonics. Most of the RFI signals are completely analysis of the PMPS using acceleration searches (Eatough
removedbythenewtechnique.
etal.inprep).Sofarthreenewpulsarshavebeendiscovered
(seeTable1& Figure8).Figure8shows folded subintegra-
tionsand integrated pulseprofilesfor each of thepulsarsin
bothastandardanalysisandafterusingthezero-DMfilter.
Inallcases impulsiveRFIhasbeenremoved.Althoughthis
demonstrates an improvement in the quality of the folded
2000 22000000
Table 1.Preliminarypropertiesofthe4newsourcesdiscovered J1539-4835 JJ11553399--44883355 ((zzeerroo--DDMM ffiilltteerreedd))
1500 11550000
in our re-analyses of the PMPS. The nominal positions quoted time (s) 1000 time (s)time (s) 11000000
are the positions of the centre of the beam in which the source 500 550000
was discovered and have errorsof lessthan 7arcmin, the radius
0 0.2 0.4 0.6 0.8 1 00 00..22 00..44 00..66 00..88 11
12000 12000
ofthePMPSbeam(Manchester etal.2001). 10000 10000
flux (arbitrary units) - 246820000000000 000000 flux (arbitrary units) - 246820000000000 000000
Name α(J2000) δ(J2000) Period(s) DM(cm−3pc) -4000 0 0.2 0.4pulse phase 0.6 0.8 1 -4000 0 0.2 0.4pulse phase 0.6 0.8 1
J1724-3549 17:24:43.0 -35:49:18.6 1.4085 550.0
2000 22000000
J1539-4835 15:39:18.7 -48:35:14.0 1.2729 136.3 J1819-1711 JJ11881199--11771111 ((zzeerroo--DDMM ffiilltteerreedd))
1500 11550000
JJ11881395--10711115 1188::1395::5103..39 --1071::1115::4187..00 00..30903551 49080..18 time (s) 1000 time (s)time (s) 11000000
500 550000
0 0.2 0.4 0.6 0.8 1 00 00..22 00..44 00..66 00..88 11
14000 14000
12000 12000
deiatthae,rtahereddisuccotvioenryooffRthFeIsefesaotuurrceessinwatsheprflimucatruilaytiaoindesdpebcy- flux (arbitrary units) 1-- 246842000000000000000 00000000 0 0.2 0.4 0.6 0.8 1 flux (arbitrary units) 1-- 246842000000000000000 00000000 0 0.2 0.4 0.6 0.8 1
pulse phase pulse phase
tra or because wide spectral filters have not been applied
aroundstrongperiodicsourcesofRFI.Ofparticularinterest
2000 22000000
J1835-0115 JJ11883355--00111155 ((zzeerroo--DDMM ffiilltteerreedd))
is PSR J1835 0115, a 5.1-millisecond pulsar in a 6-day or- 1500 11550000
bitaroundal−owmasscompanion.Allthreepulsarsarenow time (s) 1000 time (s)time (s) 11000000
500 550000
beingtimedusingradiotelescopesateitherJodrellBankor
0 0.2 0.4 0.6 0.8 1 00 00..22 00..44 00..66 00..88 11
Parkes. 35000 35000
30000 30000
re-anIanlyasdisdiotfiotnhethPeMzPerSo-uDsiMngfislitnegrlei-spbuelsinegseaaprcphlieesd(tKoeaonuer flux (arbitrary units) 1122- 550505000000000000 0000000 flux (arbitrary units) 1122- 550505000000000000 0000000
et al. in prep). Here we present one new source (see Table -10000 0 0.2 0.4 0.6 0.8 1 -10000 0 0.2 0.4 0.6 0.8 1
pulse phase pulse phase
1). This source, which has a period of 1.4s, shows single- Figure 8. Folded subintegrations and integrated pulse profiles
pulse diagnostic plots which indicate a strong resemblance for three of the pulsars discovered. For each pulsar we show the
to thenewly-discovered class of Rotating RAdioTransients standard analysis on the left and the zero-DM filtered data on
(RRATs)(McLaughlinetal.2006).Interestingly,thisobject theright.
showspulsesfromtwopartsofthepulserotationperiod,sep-
arated by about 0.2 sec. We are continuing to monitor this
sourceusing theParkesradio telescope tofurtherconstrain
signals in the fluctuation spectra from independent obser-
the spin period and to obtain a period derivative so it can
vations at different positions on the sky. Such signals likely
becomparedtothevaluesofperiodderivativemeasuredfor
have a local terrestrial origin and enter the receiver system
theother RRATs.
through the far-out sidelobes of the telescope beam. Once
theRFIsignalshavebeenidentifiedtheirharmonicsequence
is removed from the fluctuation spectrum. Typical spectral
5 DISCUSSION zapping routines can remove a few percent of the fluctua-
tionspectrumgivingasmallchancethatacoincidentpulsar
Zero-DMfilteringreducesthenumberofspuriouscandidates frequencyoritsharmonics couldberemoved.Thezero-DM
detected by pulsar search software - both in standard peri- filtering process presents a more natural way of removing
odicity searches and in single-pulse searches. A major ad- such RFI signals without thedangers inherent tozapping.
vantage of zero-DM filtering is that it eliminates the need Although effective at removing RFI in our analyses of
toapplyarbitrarycleaningtechniquestopulsarsearchdata. thePMPS,wenownoteanumberoflimitationsandpracti-
Onecommonly-usedtechniqueisthatofclippingthemulti- calities of the zero-DM filter. Firstly the technique will not
channel data based upon spikes in the DM=0 time series benefit high-frequency, or small bandwidth pulsar searches
(e.g. Hobbs et al 2004). For 1-bit sampled filterbank data because in this case even signals from celestial sources will
like that in the PMPS, with n channels, the time samples not be highly dispersed. For example, the dispersive de-
shouldhaveameanofn/2andastandarddeviationof√n/2 lay across the entire 576-MHz bandwidth in the Parkes
(e.g. Lorimer & Kramer 2005). Typical clipping algorithms methanol multi-beam pulsar survey at 6.3 GHz is less than
set each of the n channels to alternate zeros and ones if 2 ms for a source with DM=100 cm−3pc (e.g. O’Brien et
the time sample differs from the mean by more than three al.2008.). Inthiscasethezero-DMfilterwould havealow-
standarddeviations.Clippingcouldposeathreattointense frequencycutoff around 230 Hzmaking detection of all but
burst-likedispersedsignalsthatarestrongenoughtobede- millisecond pulsars impossible.
tectedinthelow-DMtrialsofapulsarsearch.Itisprecisely In single-pulse searches, impulsive RFI signals can oc-
thesetypeoftransienteventswhichmayrevealexcitingnew casionally be strong enough to persist even after zero-DM
astrophysical phenomena (Lorimer et al. 2007). Since zero- filtering.TheremnantRFIstreaksappearashighsignal-to-
DMfilteringreliesontheundispersednatureofRFI,rather noise features at non-zero DM. However such remnant RFI
than its sheer strength, such signals will not be removed. streakswillnothavetheexpecteddropoffinsignal-to-noise
The primary RFI excision technique for pulsar period- ratio as a function of trial DM, nor will they appear dis-
icitysearchesupuntilnowhasbeenfrequencydomain‘zap- persed according to Equation 1 like a true celestial source.
ping’. This method requires the identification of common Theyarealsolikelytoappearinmultiplebeamsofamulti-
beam receiver. Each of these additional properties can be Lorimer D. R., Bailes M., McLaughlin M. A., Narkevic D. J.,
used to identify such spurious signals. CrawfordF.,2007,Science,318,777
An assumption made in the analysis of the implemen- LorimerD.R.,KramerM.,2005,HandbookofPulsarAstronomy.
tation of the zero-DM filter is that of a linear dispersion CambridgeUniversityPress
LyneA.G.,SmithF.G.,2006,PulsarAstronomy,3rded..Cam-
slope when the true slope is in fact quadratic. A complete
bridgeUniversityPress,Cambridge
description of the dispersion slope increases the difficulty
ManchesterR.N.,LyneA.G.,CamiloF.,BellJ.F.,KaspiV.M.,
of implementing the algorithm, with little benefit. The ef-
D’AmicoN.,McKayN.P.F.,CrawfordF.,StairsI.H.,Pos-
fectsofthisassumptionmanifestthemselvesinphase-folded
senti A., Morris D. J., Sheppard D. C., 2001, MNRAS, 328,
pulse profiles which have asymmetric dips as shown in Fig- 17
ure 5 for PSR J1842+0257, unlike the symmetric dips we McLaughlin M. A., Lyne A. G., Lorimer D. R., Kramer M.,
haveconsidered in Figure 1. Faulkner A. J., Manchester R. N., Cordes J. M., Camilo F.,
Future pulsar surveys will be performed with higher Possenti A.,StairsI.H.,HobbsG.,D’AmicoN.,BurgayM.,
timeandfrequencyresolution2.Fast dedispersion codes are O’BrienJ.T.,2006,Nature,439,817
beingdeveloped to copewith thelarge volumeof data that O’Brien J. T., Johnston S., Kramer M., Lyne A. G., Bailes M.,
Possenti A., Burgay M., Lorimer D. R., McLaughlin M. A.,
will be produced (Bailes, private communication). These
HobbsG.,ParentD.,GuillemotL.,2008,MNRAS,388,L1
dedispersionalgorithmsoperateon1-bitor2-bitdatabefore
thesamples havebeen unpackedas floating point numbers.
Inthesealgorithms,calculationofthemeanandsubsequent
subtractionfromeachfrequencychannelsampleasinEqua-
tion 2 may not bepossible at thepre-dedispersion stage.
The factor of two increase in the number of compu-
tations imposed by re-application of the zero-DM filter af-
ter every dispersion trial might not be practical in searches
where large numbers of Fast Fourier Transformations are
performed, viz. searches for highly accelerated binary pul-
sars (e.g. Eatough et al. in prep).Anotherpractical consid-
eration is for data sampled with a larger number of bits,
i.e. a large dynamic range. In this scenario any RFI with
intensity structure across the band may ‘leak’ through the
zero-DM filter.
Wehaveimplementedthezero-DMfilterintheSigproc-
4.2pulsaranalysissoftwaresuiteandarecurrentlyapplying
theprocessinare-analysisofthePMPSinbothacceleration
searches (Eatough et al. in prep) and single-pulse searches
(Keaneet al. in prep).
ACKNOWLEDGEMENTS
This research was partly funded by grants from the Sci-
ence&TechnologyFacilities Council.EvanKeaneacknowl-
edgesthesupportofaMarie-CurieESTFellowshipwiththe
FP6 Network “ESTRELA” under contract number MEST-
CT-2005-19669. The Australia Telescope is funded by the
Commonwealth ofAustraliaforoperationasaNationalFa-
cility managed by the CSIRO. We would like to thank M.
Kramer, B. Stappers, and C. Jordan for useful discussions
and manuscript reading. We also acknowledge A. Forti and
TheUniversityofManchesterParticlePhysicsgroupforuse
of the Tier2 computingfacility3.
REFERENCES
HobbsG.,FaulknerA.,StairsI.H.,CamiloF.,ManchesterR.N.,
Lyne A. G.,KramerM.,D’AmicoN.,KaspiV. M.,Possenti
A.,McLaughlinM.A.,LorimerD.R.,BurgayM.,JoshiB.C.,
CrawfordF.,2004,MNRAS,352,1439
2 http://astronomy.swin.edu.au/pulsar/?topic=hlsurvey
3 http://www.hep.manchester.ac.uk/computing/tier2